EOMES (TBR2) Rabbit Polyclonal Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EOMES (TBR2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 26-57 amino acids from the N-terminal region of human EOMES (TBR2). |
Rabbit Polyclonal anti-EOMES antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EOMES antibody: synthetic peptide directed towards the N terminal of human EOMES. Synthetic peptide located within the following region: SVNLPGAHFYPLESARGGSGGSAGHLPSAAPSPQKLDLDKASKKFSGSLS |
Rabbit Polyclonal Anti-EOMES Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EOMES antibody: synthetic peptide directed towards the middle region of human EOMES. Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT |
Germany
Japan
United Kingdom
China