EOMES Rabbit Polyclonal Antibody

CAT#: TA343539

Rabbit Polyclonal Anti-EOMES Antibody

Product Images

WB Suggested Anti-EOMES Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EOMES antibody: synthetic peptide directed towards the middle region of human EOMES. Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 73 kDa
• Gene Name: eomesodermin
• Database Link:
  NP_005433
  Entrez Gene 8320 Human
  UniProt ID O95936
• Background: EOMES is a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential
• Synonyms: TBR2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors