Antibodies

View as table Download

Rabbit polyclonal anti-CFD (Adipsin) antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 232 of mouse Adipsin

Rabbit Polyclonal Anti-CFD Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CFD antibody: synthetic peptide directed towards the C terminal of human CFD. Synthetic peptide located within the following region: GRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSG