Antibodies

Jump to Filters
View as table Download
FAM3B Rabbit Polyclonal Antibody
TA338952

USD 375.00

5 Days

Rabbit Polyclonal Anti-FAM3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM3B antibody is: synthetic peptide directed towards the middle region of Human FAM3B. Synthetic peptide located within the following region: HWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIV
FAM3B Rabbit Polyclonal Antibody
TA349959

USD 345.00

In Stock

Rabbit Polyclonal Anti-FAM3B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FAM3B