FAM3B Rabbit Polyclonal Antibody

CAT#: TA338952

Rabbit Polyclonal Anti-FAM3B Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "FAM3B"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-FAM3B antibody is: synthetic peptide directed towards the middle region of Human FAM3B. Synthetic peptide located within the following region: HWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIV
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name family with sequence similarity 3 member B
Background FAM3B induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.
Synonyms 2-21; C21orf11; C21orf76; ORF9; PANDER; PRED44
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein, Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.