Rabbit Polyclonal VASH1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VASH1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human VASH1. |
Rabbit Polyclonal VASH1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | VASH1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human VASH1. |
Rabbit anti-VASH1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human VASH1 |
Rabbit polyclonal anti-VASH1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human VASH1. |
Rabbit Polyclonal Anti-VASH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VASH1 antibody: synthetic peptide directed towards the N terminal of human VASH1. Synthetic peptide located within the following region: ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER |
Rabbit Polyclonal Anti-VASH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VASH1 antibody: synthetic peptide directed towards the middle region of human VASH1. Synthetic peptide located within the following region: SVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLA |
Rabbit Polyclonal Anti-VASH1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |