Antibodies

Jump to Filters
View as table Download
PPP2R1A Rabbit Polyclonal Antibody
TA332922

USD 275.00

3 Weeks

Rabbit anti-PPP2R1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A
PPP2R1B Rabbit Polyclonal Antibody
TA344604

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ
PPP2R1A Rabbit Polyclonal Antibody
TA344605

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL
PPP2R1A Rabbit Polyclonal Antibody
TA345117

USD 475.00

5 Days

Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL
PPP2R1B Rabbit Polyclonal Antibody
TA314375

USD 345.00

4 Weeks

Rabbit polyclonal anti-PPP2R1B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R1B.
PP2A-alpha (PPP2CA) Goat Polyclonal Antibody
TA302738

USD 375.00

5 Days

Goat Polyclonal Antibody against PPP2CA / PPP2CB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EPHVTRRTPDYFL, from the C Terminus of the protein sequence according to NP_002706.1; NP_004147.1.
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA335806

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2CA Antibody is: synthetic peptide directed towards the N-terminal region of Human PPP2CA. Synthetic peptide located within the following region: FHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERI
PP2A-alpha (PPP2CA) Rabbit Polyclonal Antibody
TA350295

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPP2CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP2CA