Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CREB3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDF |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF7L2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7L2 Antibody: synthetic peptide directed towards the N terminal of human TCF7L2. Synthetic peptide located within the following region: MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVN |
Rabbit Polyclonal Anti-CREB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CREB1 |
USD 379.00
In Stock
Rabbit polyclonal MITF (Ser180/73) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MITF around the phosphorylation site of serine 73 (P-N-SP-P-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TCF7L1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF7L1. |
Rabbit Polyclonal CREB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB around the phosphorylation site of Serine 133 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CREB (Ser142) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB around the phosphorylation site of Serine 142 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MITF (Ser180/73) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MITF around the phosphorylation site of Serine 180/73 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE |
Rabbit Polyclonal Anti-p300 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300 |
Rabbit Polyclonal Anti-p300 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p300 Antibody: A synthesized peptide derived from human p300 |
Goat Polyclonal Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CTNNB1 / catenin beta-1 (aa108-121) Antibody: Peptide with sequence C-QIPSTQFDAAHPTN, from the internal region of the protein sequence according to NP_001895.1. |
USD 379.00
In Stock
Rabbit polyclonal Catenin-beta (Ab-489) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Rabbit polyclonal CREB (Ab-100) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CREB around the phosphorylation site of threonine 100 (S-G-TP-Q-I). |
Rabbit polyclonal CREB (Thr100) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of threonine 100 (S-G-TP-Q-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CREB3L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CREB3L2. |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Anti-TCF7 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-268 amino acids of human transcription factor 7 (T-cell specific, HMG-box) |
Rabbit polyclonal CREB1 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CREB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 105-132 amino acids from the Central region of human CREB1. |
Rabbit Polyclonal CREB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CREB |
Rabbit Polyclonal Catenin-β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β |
Rabbit Polyclonal Catenin- beta (Ser33) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Serine 33 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin- beta (Tyr489) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin- beta around the phosphorylation site of Tyrosine 489 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Catenin-β (Ser37) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Catenin-β around the phosphorylation site of Serine 37 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MITF Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MITF |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit polyclonal Catenin-beta (Ab-552) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internalof human CTNNB1. |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
| Modifications | Phospho-specific |
Active filters
Conjugates
- Unconjugated
Families
- Transcription Factors
Pathways
- Melanogenesis