Rabbit Polyclonal Anti-C16orf80 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-C16orf80 antibody: synthetic peptide directed towards the middle region of human C16orf80. Synthetic peptide located within the following region: AYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAK |
Rabbit Polyclonal Anti-C16orf80 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-C16orf80 Antibody: synthetic peptide directed towards the middle region of human C16orf80. Synthetic peptide located within the following region: IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICT |
Rabbit Polyclonal Anti-C16orf80 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTL3 Antibody: synthetic peptide directed towards the C terminal of human GTL3. Synthetic peptide located within the following region: YGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ |
Germany
Japan
United Kingdom
China