Antibodies

Jump to Filters
View as table Download
ENPP2 Goat Polyclonal Antibody
TA321030

USD 375.00

2 Weeks

Goat Polyclonal Anti-ENPP2 / AUTOTAXIN (aa698-712) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen internal region of NP_006200.3; NP_001035181.1, NP_001124335.1 (PDHLTSCVRPDVRVS)
ENPP2 Rabbit Polyclonal Antibody
TA335975

USD 375.00

5 Days

Rabbit Polyclonal Anti-ENPP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENPP2 Antibody: synthetic peptide directed towards the N terminal of human ENPP2. Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA