Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-HSF2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HSF2. |
Antibodies
View as table Download
Rabbit polyclonal HSF2 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSF2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 216-245 amino acids from the Central region of human HSF2. |
Rat Monoclonal Anti-HSF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Guinea Pig, Hamster, Monkey, Rabbit. Dog, Bovine, Sheep, Pig |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSF2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSF2 antibody: synthetic peptide directed towards the middle region of human HSF2. Synthetic peptide located within the following region: SSVQMNPTDYINNTKSENKGLETTKNNVVQPVSEEGRKSKSKPDKQLIQY |
Rabbit Polyclonal Anti-Hsf2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Hsf2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SAIEQGSTTASSEVVPSVDKPIEVDELLDSSLDPEPTQSKLVRLEPLTEA |
Rat anti Heat Shock Factor 2 Monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSF2 mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSF2 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSF2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSF2 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSF2 mouse monoclonal antibody, clone OTI5C1 (formerly 5C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-HSF2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-HSF2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
HSF2 mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI2E2 (formerly 2E2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI4G9 (formerly 4G9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI2F11 (formerly 2F11)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI4B2 (formerly 4B2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI5C1 (formerly 5C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
HSF2 mouse monoclonal antibody, clone OTI5C1 (formerly 5C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- HSF2
Conjugates
- Unconjugated
Families
- Transcription Factors