Antibodies

View as table Download

Rabbit polyclonal anti-NFIL3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NFIL3.

Goat Polyclonal Antibody against NFIL3

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RLIATQPISASDSG, from the C Terminus of the protein sequence according to NP_005375.2.

Rabbit Polyclonal anti-NFIL3 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the middle region of human NFIL3. Synthetic peptide located within the following region: GYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIHSPV

Rabbit Polyclonal Anti-NFIL3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NFIL3 antibody: synthetic peptide directed towards the N terminal of human NFIL3. Synthetic peptide located within the following region: MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEDVLLSEG