Rabbit Polyclonal Anti-ZNF286 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF286 antibody: synthetic peptide directed towards the C terminal of human ZNF286. Synthetic peptide located within the following region: GKAFIHSSALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP |
Rabbit Polyclonal Anti-ZNF286A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ZNF286A antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF286A. Synthetic peptide located within the following region: KSNLMKKQRTYKEKKPHKCNDCGELFTYHSVLIRHQRVHTGEKPYTCNEC |
Rabbit Polyclonal Anti-ZNF286 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF286 antibody: synthetic peptide directed towards the N terminal of human ZNF286. Synthetic peptide located within the following region: GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK |
Rabbit Polyclonal Anti-ZNF286A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF286A antibody: synthetic peptide directed towards the N terminal of human ZNF286A. Synthetic peptide located within the following region: SSYSDMETRPQSKDSTSVQDFSKAESCKVAIIDRLTRNSVYDSNLEAALE |
Carrier-free (glycerol/BSA-free) ZNF286A mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF286A mouse monoclonal antibody, clone OTI3D6 (formerly 3D6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF286A mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF286A mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF286A mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ZNF286A mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI2D1 (formerly 2D1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI3D6 (formerly 3D6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI3D6 (formerly 3D6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI7H4 (formerly 7H4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ZNF286A mouse monoclonal antibody, clone OTI6A5 (formerly 6A5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
