USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
USD 375.00
5 Days
Rabbit Polyclonal Anti-G6pc Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI |
Rabbit polyclonal anti-B4GALT1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human B4GALT1. |
Rabbit Polyclonal Anti-GAA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GAA antibody: synthetic peptide directed towards the N terminal of human GAA. Synthetic peptide located within the following region: FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL |
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH |
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD |
Rabbit Polyclonal Anti-B4GALT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-B4GALT2 Antibody: synthetic peptide directed towards the middle region of human B4GALT2. Synthetic peptide located within the following region: NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR |
Mouse monoclonal Anti-Mlac6 Clone 4E10 10.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac10 Clone 6G11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac9 Clone 3B6.1/2.F11
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac5 Clone 3G5.1/2.G6
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac4 Clone 7C10-7.1
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac3 Clone 4C9 1.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mbbm1 Clone VA4-20B
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Mlac8 Clone 3F4 G5E3
| Reactivities | Rabbit |
| Conjugation | Unconjugated |
USD 428.00
2 Weeks
USD 180.00
2 Weeks
USD 428.00
2 Weeks
USD 180.00
2 Weeks
USD 428.00
2 Weeks
USD 180.00
2 Weeks
Germany
Japan
United Kingdom
China
