Antibodies

Jump to Filters
View as table Download
Galanin (GAL) Goat Polyclonal Antibody
TA311451

USD 375.00

2 Weeks

Goat Anti-GAL Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HRSFSDKNGLTSK, from the internal region of the protein sequence according to NP_057057.2.
Galanin (GAL) Rabbit Polyclonal Antibody
TA330441

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-GAL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN