Galanin (GAL) Rabbit Polyclonal Antibody

CAT#: TA330441

Rabbit Polyclonal Anti-GAL Antibody

Product Images

WB Suggested Anti-GAL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Transfected 293TGAL is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GAL antibody: synthetic peptide directed towards the middle region of human GAL. Synthetic peptide located within the following region: LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPGSFDRSIPENN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: galanin and GMAP prepropeptide
• Database Link:
  NP_057057
  Entrez Gene 51083 Human
  UniProt ID P22466
• Background: Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions.
• Synonyms: GAL-GMAP; GALN; GLNN; GMAP
• Note: Immunogen sequence homology: Human: 100%; Dog: 76%

Reference Data

• Protein Families: Secreted Protein, Transmembrane