Rabbit Polyclonal Anti-K2P6.1
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)ESHQQLSASSHTDYASIPR, corresponding to residues 295-313 of human K2P6.1 (TWIK-2).Intracellular, C-terminus. |
Rabbit Polyclonal Anti-K2P6.1
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)ESHQQLSASSHTDYASIPR, corresponding to residues 295-313 of human K2P6.1 (TWIK-2).Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNK6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK6 antibody: synthetic peptide directed towards the n terminal of human KCNK6. Synthetic peptide located within the following region: RLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGK |