Antibodies

Jump to Filters
View as table Download
SLCO2B1 Rabbit Polyclonal Antibody
TA333894

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLCO2B1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLCO2B1 Antibody: synthetic peptide directed towards the N terminal of human SLCO2B1. Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ