SLCO2B1 Rabbit Polyclonal Antibody

CAT#: TA333894

Rabbit Polyclonal Anti-SLCO2B1 Antibody

Product Images

Host: Rabbit; Target Name: SLCO2B1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SLCO2B1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-SLCO2B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysate;SLCO2B1 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Rabbit Anti-SLCO2B1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue; Observed Staining: Membrane in alveolar type I cells; Primary Antibody Concentration: 1:100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rab

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLCO2B1 Antibody: synthetic peptide directed towards the N terminal of human SLCO2B1. Synthetic peptide located within the following region: DPQDVRPSVFHNIKLFVLCHSLLQLAQLMISGYLKSSISTVEKRFGLSSQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 77 kDa
• Gene Name: solute carrier organic anion transporter family member 2B1
• Database Link:
  NP_009187
  Entrez Gene 11309 Human
  UniProt ID O94956
• Background: SLCO2B1 mediates the Na+-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
• Synonyms: OATP-B; OATP2B1; OATPB; SLC21A9
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane