Antibodies

Jump to Filters
View as table Download
TOR2A Rabbit Polyclonal Antibody
TA342101

USD 310.00

5 Days

Rabbit Polyclonal Anti-TOR2A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TOR2A antibody: synthetic peptide directed towards the N terminal of human TOR2A. Synthetic peptide located within the following region: GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS
TOR2A Rabbit Polyclonal Antibody
TA354950

USD 355.00

5 Days

Rabbit anti TOR2A Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated