TOR2A Rabbit Polyclonal Antibody

CAT#: TA342101

Rabbit Polyclonal Anti-TOR2A Antibody

Product Images

WB Suggested Anti-TOR2A Antibody Titration: 1.25 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TOR2A antibody: synthetic peptide directed towards the N terminal of human TOR2A. Synthetic peptide located within the following region: GLECDLAQHLAGQHLAKALVVKALKAFVRDPAPTKPLVLSLHGWTGTGKS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: torsin family 2 member A
• Database Link:
  NP_001078816
  Entrez Gene 27433 Human
  UniProt ID Q5JU69
• Background: The function remains unknown.
• Synonyms: TORP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Families: Secreted Protein, Transmembrane