Antibodies

Jump to Filters
View as table Download
PKM2 (PKM) Rabbit Polyclonal Antibody
TA326808

USD 275.00

3 Weeks

PKM2 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human PKM2
PKM2 (PKM) Rabbit Polyclonal Antibody
TA344600

USD 475.00

5 Days

Rabbit Polyclonal Anti-PKM2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the middle region of human PKM2. Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ
PKM2 (PKM) Rabbit Polyclonal Antibody
TA344601

USD 475.00

5 Days

Rabbit Polyclonal Anti-PKM2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the N terminal of human PKM2. Synthetic peptide located within the following region: MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICT
PKM2 (PKM) Rabbit Polyclonal Antibody
TA347826

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PKM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PKM2 Antibody: Peptide sequence around aa.405~409(T-S-D-P-T) derived from Human PKM2.
PKM2 (PKM) Rabbit Polyclonal Antibody
TA324317

USD 450.00

5 Days

Rabbit polyclonal Pyruvate Kinase (PKM2) Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This Pyruvate Kinase (PKM2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-505 amino acids from the C-terminal region of human Pyruvate Kinase (PKM2).
PKM2 (PKM) Rabbit Polyclonal Antibody
TA327597

USD 345.00

3 Weeks

Phospho-PKM2-S37 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S37 of human PKM2
PKM2 (PKM) Rabbit Polyclonal Antibody
TA322978

USD 345.00

In Stock

Anti-PKM2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2
PKM2 (PKM) Rabbit Polyclonal Antibody
TA322979

USD 345.00

In Stock

Anti-PKM2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2
PKM2 (PKM) Rabbit Polyclonal Antibody
TA351941

USD 345.00

In Stock

Rabbit Polyclonal Anti-PKM Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PKM