Antibodies

Jump to Filters
View as table Download
VAMP5 Rabbit Polyclonal Antibody
TA341852

USD 310.00

5 Days

Rabbit Polyclonal Anti-VAMP5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
VAMP5 Rabbit Polyclonal Antibody
TA350595

USD 345.00

In Stock

Rabbit Polyclonal Anti-VAMP5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein