VAMP5 Rabbit Polyclonal Antibody

CAT#: TA341852

Rabbit Polyclonal Anti-VAMP5 Antibody

Product Images

WB Suggested Anti-VAMP5 Antibody Titration: 5.0 ug/ml; Positive Control: Human Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VAMP5 antibody: synthetic peptide directed towards the middle region of human VAMP5. Synthetic peptide located within the following region: IRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: vesicle associated membrane protein 5
• Database Link:
  NP_006625
  Entrez Gene 10791 Human
  UniProt ID O95183
• Background: Synaptobrevins/VAMPs, syntaxins, andThe 25-kD synaptosomal-associated protein areThe main components of a protein complex involved inThe docking and/or fusion of vesicles and cell membranes.The VAMP5 gene is a member ofThe vesicle-associated membrane protein (VAMP)/synaptobrevin family andThe SNARE superfamily.This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]
• Synonyms: MYOBREVIN; myobrevin; vesicle-associated membrane protein 5; vesicle-associated membrane protein 5 (myobrevin)
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport