Rabbit Polyclonal Anti-CAPZB Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Capzb antibody is: synthetic peptide directed towards the C-terminal region of Rat Capzb. Synthetic peptide located within the following region: VEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEAL |
Rabbit Polyclonal antibody to CAPZB (capping protein (actin filament) muscle Z-line, beta)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 256 of CAPZB |
Goat Polyclonal Antibody against CAPZB
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NDLVEALKRKQQC, from the C Terminus of the protein sequence according to NP_004921. |
CAPZB Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-272 of human CAPZB (NP_004921.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
