Rabbit polyclonal anti-A4GNT antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human A4GNT. |
Rabbit polyclonal anti-A4GNT antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human A4GNT. |
Rabbit Polyclonal Anti-A4GNT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT. Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME |
Rabbit Polyclonal Anti-A4GNT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the C terminal of human A4GNT. Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV |
Anti-A4GNT Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 28-340 amino acids of human alpha-1,4-N-acetylglucosaminyltransferase |
Anti-A4GNT Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 28-340 amino acids of human alpha-1,4-N-acetylglucosaminyltransferase |
A4GNT Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human A4GNT (NP_057245.1). |
Modifications | Unmodified |