Antibodies

View as table Download

Rabbit polyclonal anti-A4GNT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human A4GNT.

Rabbit Polyclonal Anti-A4GNT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the N terminal of human A4GNT. Synthetic peptide located within the following region: LLLVCGFLYQFTLKSSCLFCLPSFKSHQGLEALLSHRRGIVFLETSERME

Rabbit Polyclonal Anti-A4GNT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-A4GNT antibody: synthetic peptide directed towards the C terminal of human A4GNT. Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV

Anti-A4GNT Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 28-340 amino acids of human alpha-1,4-N-acetylglucosaminyltransferase

Anti-A4GNT Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 28-340 amino acids of human alpha-1,4-N-acetylglucosaminyltransferase

A4GNT Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human A4GNT (NP_057245.1).
Modifications Unmodified