Rabbit Polyclonal DCLK1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | DCLK1 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human DCLK1. The immunogen is located within the last 50 amino acids of DCLK1. |
Rabbit Polyclonal Anti-DCLK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCLK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DCLK1. Synthetic peptide located within the following region: IFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPGPSR |
Rabbit Polyclonal Anti-DCLK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DCLK1 |
DCAMKL1/DCLK1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 630-729 of human DCAMKL1/DCAMKL1/DCLK1 (NP_004725.1). |
| Modifications | Unmodified |
DCAMKL1/DCLK1 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic Peptide of human DCAMKL1/DCAMKL1/DCLK1 |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
