DCAMKL1 (DCLK1) Rabbit Polyclonal Antibody

CAT#: TA338176

Rabbit Polyclonal Anti-DCLK1 Antibody

Product Images

Host: Rabbit; Target Name: DCLK1; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DCLK1 antibody is: synthetic peptide directed towards the C-terminal region of Human DCLK1. Synthetic peptide located within the following region: IFIACGPEKFRYQDDFLLDESECRVVKSTSYTKIASSSRRSTTKSPGPSR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: doublecortin like kinase 1
• Database Link:
  NP_004725
  Entrez Gene 9201 Human
  UniProt ID O15075
• Background: The function of this protein remains unknown.
• Synonyms: CL1; CLICK1; DCAMKL1; DCDC3A; DCLK
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 92%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase