Rabbit Polyclonal Anti-DNAJC12 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAJC12 antibody: synthetic peptide directed towards the middle region of human DNAJC12. Synthetic peptide located within the following region: EQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYE |
Rabbit Polyclonal Anti-DNAJC12 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Dnajc12 antibody is synthetic peptide directed towards the middle region of Mouse Dnajc12. Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR |
DNAJC12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-198 of human DNAJC12 (NP_068572.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
