DNAJC12 Rabbit Polyclonal Antibody

CAT#: TA344721

Rabbit Polyclonal Anti-DNAJC12 Antibody - middle region

Product Images

Host: Rabbit; Target Name: Dnajc12; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Dnajc12 antibody is synthetic peptide directed towards the middle region of Mouse Dnajc12. Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: DnaJ heat shock protein family (Hsp40) member C12
• Database Link:
  NP_068572
  Entrez Gene 30045 Mouse
  UniProt ID Q9UKB3
• Background: The function of this protein remains unknown.
• Synonyms: JDP1
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%; Zebrafish: 85%; Goat: 82%