Antibodies

Jump to Filters
View as table Download
DPPA5 Rabbit Polyclonal Antibody
TA344221

USD 475.00

5 Days

Rabbit Polyclonal Anti-DPPA5 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPPA5 antibody: synthetic peptide directed towards the N terminal of human DPPA5. Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
DPPA5 Rabbit Polyclonal Antibody
TA375605

USD 220.00

3 Weeks

DPPA5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-116 of human DPPA5 (NP_001020461.1).