DPPA5 Rabbit Polyclonal Antibody

CAT#: TA344221

Rabbit Polyclonal Anti-DPPA5 Antibody - N-terminal region

Product Images

WB Suggested Anti-DPPA5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DPPA5 antibody: synthetic peptide directed towards the N terminal of human DPPA5. Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: developmental pluripotency associated 5
• Database Link:
  NP_001020461
  Entrez Gene 340168 Human
  UniProt ID A6NC42
• Background: DPPA5 is involved in the maintenance of embryonic stem (ES) cell pluripotency. DPPA5 is dispensable for self-renewal of pluripotent ES cells and establishment of germ cells. DPPA5 is associates with specific target mRNAs.
• Synonyms: ESG1
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Rabbit: 93%; Dog: 92%; Rat: 92%; Pig: 79%