Antibodies

View as table Download

Rabbit Polyclonal Anti-FHL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-FHL1 Antibody: synthetic peptide directed towards the C terminal of human FHL1. Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS

Goat Polyclonal Antibody against FHL1 / SLIM1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CNKRFVFHNEQVY, from the internal region of the protein sequence according to NP_001440.

Goat Polyclonal Antibody against SLIMMER / FHL1 isoform B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CTVSRVSHPVSKARK, from the internal region of the protein sequence according to AAC72886.1.

Rabbit Polyclonal anti-FHL1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FHL1 antibody: synthetic peptide corresponding to a region of Human. Synthetic peptide located within the following region: SKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK

Rabbit Polyclonal Anti-FHL1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FHL1

FHL1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FHL1

FHL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 27-296 of human FHL1 (NP_001153171.1).
Modifications Unmodified