FHL1 Rabbit Polyclonal Antibody

CAT#: TA329448

Rabbit Polyclonal anti-FHL1 antibody

Product Images

WB Suggested Anti-FHL1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: FHL1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: FHL1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FHL1 antibody: synthetic peptide corresponding to a region of Human. Synthetic peptide located within the following region: SKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: four and a half LIM domains 1
• Database Link:
  NP_001440
  Entrez Gene 14199 MouseEntrez Gene 2273 Human
  UniProt ID Q13642
• Background: LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.FHL1 contains 3 LIM zinc-binding domains. It may have an involvement in muscle development or hypertrophy.LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: FHL-1; FHL1A; FHL1B; FLH1A; KYOT; SLIM; SLIM-1; SLIM1; SLIMMER; XMPMA
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Human: 92%