Antibodies

View as table Download

Rabbit Polyclonal Anti-MSH5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MSH5

Rabbit Polyclonal Anti-MSH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH5 antibody: synthetic peptide directed towards the N terminal of human MSH5. Synthetic peptide located within the following region: DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP

Rabbit Polyclonal Anti-MSH5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH5 antibody: synthetic peptide directed towards the N terminal of human MSH5. Synthetic peptide located within the following region: KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI

MSH5 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MSH5

MSH5 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human MSH5 (NP_751897.1).
Modifications Unmodified