MSH5 Rabbit Polyclonal Antibody

CAT#: TA346021

Rabbit Polyclonal Anti-MSH5 Antibody

Product Images

WB Suggested Anti-MSH5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: HepG2 cell lysateThere is BioGPS gene expression data showing that MSH5 is expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSH5 antibody: synthetic peptide directed towards the N terminal of human MSH5. Synthetic peptide located within the following region: DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 93 kDa
• Gene Name: mutS homolog 5
• Database Link:
  NP_751897
  Entrez Gene 4439 Human
  UniProt ID O43196
• Background: MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4. This gene encodes a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4. Alternative splicing results in four transcript variants encoding three different isoforms.
• Synonyms: G7; MUTSH5; NG23
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Dog: 86%; Mouse: 86%; Pig: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome