Antibodies

View as table Download

NTF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NTF3

Rabbit polyclonal anti-NT-3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed recombinant human NT-3

Rabbit polyclonal Anti-Ntf3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ntf3 antibody is: synthetic peptide directed towards the N-terminal region of Ntf3. Synthetic peptide located within the following region: LAYLRGIQGNNMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENY

NTF3 rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NTF3

NTF3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human NTF3

NTF3 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-257 of human NTF3 (NP_002518.1).
Modifications Unmodified