Antibodies

Jump to Filters
View as table Download
PAPSS2 Rabbit Polyclonal Antibody
TA346730

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAPSS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN
PAPSS2 Rabbit Polyclonal Antibody
TA366316

USD 380.00

4 Weeks

PAPSS2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PAPSS2
PAPSS2 Rabbit Polyclonal Antibody
TA370664

USD 380.00

4 Weeks

PAPSS2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PAPSS2