Rabbit Polyclonal STIM2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STIM2 antibody was raised against a 17 amino acid peptide from near the center of human STIM2. |
Rabbit Polyclonal STIM2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STIM2 antibody was raised against a 17 amino acid peptide from near the center of human STIM2. |
Rabbit Polyclonal STIM2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | STIM2 antibody was raised against a 18 amino acid peptide from near the carboxy terminus of human STIM2. |
Rabbit Polyclonal Anti-STIM2 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Stim2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stim2. Synthetic peptide located within the following region: IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS |
STIM2 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human STIM2 (NP_001162588). |
Modifications | Unmodified |