STIM2 Rabbit Polyclonal Antibody

CAT#: TA343352

Rabbit Polyclonal Anti-STIM2 Antibody

Product Images

Host: Rabbit; Target Name: Stim2; Sample Tissue: Mouse Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Stim2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stim2. Synthetic peptide located within the following region: IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 91 kDa
• Gene Name: stromal interaction molecule 2
• Database Link:
  NP_001162589
  Entrez Gene 116873 Mouse
  UniProt ID Q9P246
• Background: The function of this protein remains unknown.
• Synonyms: FLJ39527; KIAA1482
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Rabbit: 86%