UBE4B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBE4B |
UBE4B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBE4B |
Rabbit polyclonal antibody to UBE4B (ubiquitination factor E4B (UFD2 homolog, yeast))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 869 and 1179 of UBE4B (Uniprot ID#O95155) |
Rabbit Polyclonal Anti-UBE4B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE4B antibody: synthetic peptide directed towards the N terminal of human UBE4B. Synthetic peptide located within the following region: SPMFCSVASFGASSLSSLYESSPAPTPSFWSSVPVMGPSLASPSRAASQL |
UBE4B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human UBE4B |
UBE4B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-250 of human UBE4B (NP_006039.2). |
Modifications | Unmodified |