Rabbit Polyclonal Anti-NPY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NPY antibody is: synthetic peptide directed towards the middle region of Human NPY. Synthetic peptide located within the following region: CLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRYGKRSSP |
Carrier-free (BSA/glycerol-free) NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-NPY Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NPY mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
