Rabbit anti-GSTO2 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTO2 |
Rabbit anti-GSTO2 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GSTO2 |
Rabbit polyclonal Anti-GSTO2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GSTO2 antibody: synthetic peptide directed towards the N terminal of human GSTO2. Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GSTO2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI2A12 (formerly 2A12)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GSTO2 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI4H1 (formerly 4H1)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GSTO2 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI4H7 (formerly 4H7)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
GSTO2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".