GSTO2 Rabbit Polyclonal Antibody

CAT#: TA331016

Rabbit polyclonal Anti-GSTO2 Antibody

Product Images

WB Suggested Anti-GSTO2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GSTO2 antibody: synthetic peptide directed towards the N terminal of human GSTO2. Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: glutathione S-transferase omega 2
• Database Link:
  NP_899062
  Entrez Gene 119391 Human
  UniProt ID Q9H4Y5
• Background: The omega class glutathione transferases (GST; EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1).
• Synonyms: bA127L20.1; GSTO 2-2
• Note: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Horse: 86%; Guinea pig: 86%; Yeast: 77%

Reference Data

• Protein Pathways: Drug metabolism - cytochrome P450, Glutathione metabolism, Metabolism of xenobiotics by cytochrome P450