Antibodies

Jump to Filters
View as table Download
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA312524

USD 345.00

In Stock

Rabbit polyclonal anti-KAP0 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0.
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA344577

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRKAR1A Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRKAR1A antibody: synthetic peptide directed towards the C terminal of human PRKAR1A. Synthetic peptide located within the following region: MNRPRAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLS
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA344578

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRKAR1A Antibody - N-terminal region

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Prkar1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Prkar1a. Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Rabbit Polyclonal Antibody
TA324281

USD 345.00

4 Weeks

Anti-PRKAR1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 250 amino acids of human protein kinase, cAMP-dependent, regulatory, type I, alpha
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Mouse Monoclonal Antibody [Clone ID: OTI6C7]
CF500641

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PRKAR1A mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Mouse Monoclonal Antibody [Clone ID: OTI6C7]
TA500641

USD 379.00

In Stock

Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Protein Kinase A regulatory subunit I alpha (PRKAR1A) Mouse Monoclonal Antibody [Clone ID: OTI6C7]
TA500641S

USD 159.00

In Stock

Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated