Goat Anti-ALOX15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3. |
Goat Anti-ALOX15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HYKTDVAVKDDPE, from the internal region of the protein sequence according to NP_001131.3. |
Rabbit polyclonal Anti-ALOX15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALOX15 antibody: synthetic peptide directed towards the middle region of human ALOX15. Synthetic peptide located within the following region: QHASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASL |
Rabbit anti 15-Lox-1 Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ALOX15 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ALOX15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ALOX15 |
ALOX15 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALOX15 mouse monoclonal antibody, clone OTI2G3 (formerly 2G3)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALOX15 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALOX15 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
ALOX15 mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)
Applications | IF, IHC, WB |
Reactivities | Human, Monkey, Rat, Dog |
Conjugation | Unconjugated |
ALOX15 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ALOX15 mouse monoclonal antibody, clone OTI7H6 (formerly 7H6)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |