Antibodies

View as table Download

Rabbit Polyclonal Anti-GNPDA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GNPDA1 antibody: synthetic peptide directed towards the C terminal of human GNPDA1. Synthetic peptide located within the following region: EGVNHMWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVD

Rabbit Polyclonal GNPDA1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GNPDA1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human GNPDA1.

Rabbit Polyclonal GNPDA1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acids 100-150 of human GNPDA1 was used as the immunogen for the antibody.