Antibodies

Jump to Filters
View as table Download
Sterol carrier protein 2 (SCP2) Rabbit Polyclonal Antibody
TA325058

USD 450.00

5 Days

Rabbit polyclonal SCP2 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SCP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-385 amino acids from the Central region of human SCP2.
Sterol carrier protein 2 (SCP2) Rabbit Polyclonal Antibody
TA342201

USD 375.00

5 Days

Rabbit polyclonal Anti-SCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SCP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SCP2. Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI
Sterol carrier protein 2 (SCP2) Rabbit Polyclonal Antibody
TA342202

USD 375.00

5 Days

Rabbit polyclonal Anti-SCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCP2 antibody: synthetic peptide directed towards the middle region of human SCP2. Synthetic peptide located within the following region: NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILA
Sterol carrier protein 2 (SCP2) Mouse Monoclonal Antibody [Clone ID: OTI1E4]
CF507247

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SCP2 mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sterol carrier protein 2 (SCP2) Mouse Monoclonal Antibody [Clone ID: OTI1D2]
CF507248

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SCP2 mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sterol carrier protein 2 (SCP2) Mouse Monoclonal Antibody [Clone ID: OTI3H1]
CF507254

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) SCP2 mouse monoclonal antibody, clone OTI3H1 (formerly 3H1)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Sterol carrier protein 2 (SCP2) Mouse Monoclonal Antibody [Clone ID: OTI3F5]
CF507255

USD 465.00

In Stock

Carrier-free (glycerol/BSA-free) SCP2 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated