IFIH1 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IFIH1 |
IFIH1 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IFIH1 |
Rabbit Polyclonal MDA5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | MDA5 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human MDA5. |
Rabbit Polyclonal MDA5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | MDA5 antibody was raised against a 16 amino acid peptide from near the center of human MDA5. |
Rabbit polyclonal IFIH1 (MDA5) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human IFIH1. |
Goat Polyclonal Antibody against IFIH1 (MDA5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SNGYSTDENFRYL-C, from the N Terminus of the protein sequence according to NP_071451.2. |
Rabbit Polyclonal Anti-IFIH1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IFIH1 antibody: synthetic peptide directed towards the middle region of human IFIH1. Synthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody,clone OTI1C7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IFIH1 mouse monoclonal antibody,clone OTI12A6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 mouse monoclonal antibody,clone OTI1C7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 mouse monoclonal antibody,clone OTI1C7
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI8C10 (formerly 8C10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 (MDA5) mouse monoclonal antibody, clone OTI11C11 (formerly 11C11)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 mouse monoclonal antibody,clone OTI12A6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
IFIH1 mouse monoclonal antibody,clone OTI12A6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |