Rabbit polyclonal CNOT2 (Ab-101) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Rabbit polyclonal CNOT2 (Ser101) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: SYKDPTSSNDDSKSNLNTSGKTTSSTDGPKFPGDKSSTTQNNNQQKKGIQ |
Rabbit Polyclonal Anti-CNOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT2 antibody: synthetic peptide directed towards the middle region of human CNOT2. Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS |
CNOT2 mouse monoclonal antibody, clone OTI5A12 (formerly 5A12)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CNOT2 mouse monoclonal antibody, clone OTI6D7 (formerly 6D7)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CNOT2 mouse monoclonal antibody, clone OTI9B10 (formerly 9B10)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China
